Work Experience

  • 2015 2012

    Öğretim Üyesi

    Yakın Doğu Üniversitesi, Türkçe Hazırlık Okulu

  • 2015 2011

    Öğretim Üyesi

    Yakın Doğu Üniversitesi, Türk Dili ve Edebiyatı Bölümü

  • 2010 2008

    Öğretim Görevlisi

    Yakın Doğu Üniversitesi, Türkçe Öğretmenliği Bölümü

  • 2015 2007

    Yardımcı Doçent / Assistant Professor

    Yakın Doğu Üniversitesi, Türk Dili ve Edebiyatı

Education & Training

  • Ph.D. 2010

    Türk Halk Bilimi

    Ege Üniversitesi

  • Master2003

    Türk Halk Bilimi

    Ege Üniversitesi

  • Bachelor2001

    Türk Dili ve Edebiyatı

    EMU

Honors, Awards and Grants

Research Projects

Filter by type:

Sort by year:

Kazakistan Sahası Köroğlu Destanı ile Koblandı Batır Destanı’nda Aile ve Kadın Tipler

Book Chapter Prof. Dr. Fikret Türkmen Armağanı, Kanyılmaz Matbaası, Volume -, Issue -, 2005, Pages 259-276

Abstract

-


Özet

-

Kıbrıs Türk Gölge Oyunu Karagöz Üzerine Bir İnceleme

Book Chapter Prof. Dr. Fikret Türkmen Kitabı, Volume yok, Issue yok, 2012, Pages 311-316

Abstract

yok


Özet

yok

Hasan Bulliler (Hasan Bulliler Destanı) ile Seyit Noçi (Seyit Noçi Destanı) Destan Kahramanlarının Tip Yönünden Karşılaştırılması

Original Article XI. KIBATEK Uluslar Arası Edebiyat Şöleni bildirileri kitabı, Volume yok, Issue yok, 2005, Pages 88-93

Abstract

yok


Özet

Hasan Bulliler Destanı Kıbrıs Türklerine; Seyit Noçi Destanı da Uygur Türklerine ait ve son yüzyılda şekillenen destanlardır. Hasan Bulli ve Seyit Noçi yaşadıkları toplum tarafından birer kahraman olarak görülen ve ülkelerindeki baskıcı yönetimlere karşı çıkmış olan iki destan kahramanıdır. Çalışmamızda ilk olarak Hasan Bulliler ve Seyit Noçi adlı destan kahramanlarının karakter özellikleri incelenecek, daha sonra ise Alp tipi ile olan benzerlik ve farklılıkları ortaya konulacaktır.

Türk Edebiyatında Yer Alan Mizahi Şiirler

Original Article Türk Kültürü, Volume *, Issue -, 2006, Pages -

Abstract

-


Özet

-

Buket Uzuner’in 'Bir Siyah Saçlı Kadının Gezi Notları' Adlı Eseri Üzerine Bir Değerlendirme

Original Article KIBATEK Gezi Edebiyatı Sempozyumu bildiri kitabı, Volume yok, Issue yok, 2006, Pages yok

Abstract

yok


Özet

yok

Kıbrıs Türk Halk Efsanelerinde Yer Alan Şekil Değiştirme Motifleri ve Mitolojik Unsurlar Üzerine Bir İnceleme

Original Article XII. KIBATEK Uluslar Arası Edebiyat Şöleni bildirileri kitabı, Volume yok, Issue yok, 2006, Pages 42-45

Abstract

yok


Özet

Kıbrıs Türk halk efsaneleri Anadolu efsaneleriyle genel olarak aynı yapı özelliklerine sahip olan efsanelerdir. Bunun yanında Kıbrıs Türk halk efsanelerinde geçen mekân isimlerinin birçoğunun Kıbrıs’a özgü olduğunu görmekteyiz. Bu efsanelerdeki değişme motiflerine baktığımız zaman yine bütün Türk efsaneleriyle benzer özellikler gösterdiğini görmekteyiz. Şöyle ki, şekil değiştirme durumu Kıbrıs Türk halk efsanelerinde de, iyiler için bir kurtuluş kötüler içinse bir cezalandırmadır. Mitolojik unsurların da yine Türk mitolojisiyle benzerlik gösterdiğini görmekteyiz. Fakat Türk mitolojisinden farklı olarak, Yunan mitolojisine ait olan ‘Afrodit’ mitolojik motifinin de bu efsanelerde yer aldığını görmekteyiz.

Kıbrıs Türk Halk Masalları ve Uygur Türk Halk Masallarında Yer Alan Bazı Motifler Üzerine Bir Değerlendirme

Original Article XIII. KIBATEK Edebiyat Sempozyumu Bildiri kitabı, Volume yok, Issue yok, 2007, Pages 69-76

Abstract

yok


Özet

yok

Kıbrıs Türk Halk Masallarında Yer Alan Sayılar ve Motifler Üzerine Bir İnceleme

Original Article I. Uluslararası Türk Dünyası Kültür Kurultayı bildirileri kitabı, Volume yok, Issue yok, 2007, Pages 901-910

Abstract

yok


Özet

yok

Kıbrıs Türk Tiyatrosu ve Toplumsal Direniş

Original Article XIV. KIBATEK Edebiyat Sempozyumu bildiri kitabı, Volume yok, Issue yok, 2007, Pages 159-164

Abstract

yok


Özet

yok

Kıbrıslı Türk Şairlerin Oluşturduğu ‘Adalı, Akdenizli ve Evrensel’ Edebiyat

Original Article KIBATEK Uluslar Arası Türk Kültüründe Deniz ve Deniz Edebiyatı Sempozyumu bildiriler kitabı, Volume yok, Issue yok, 2008, Pages 37-50

Abstract

yok


Özet

yok

Kıbrıs Türk Şiirinin Millî Mücadelemizdeki Yeri

Original Article Kıbrıs Türk Milli Mücadelesi ve Bu Mücadelede Türk Mukavemet Teşkilatı'nın Yeri sempozyumu bildiriler kitabı, Volume yok, Issue yok, 2009, Pages 57-66

Abstract

yok


Özet

yok

Batı Trakya ve Kıbrıs Türklerinin Millî Benliklerinin Korunmasında Edebiyatın Etkisi

Original Article Türk Dünyası İncelemeleri Dergisi, Volume *, Issue -, 2009, Pages -

Abstract

-


Özet

-

Tahir ile Zühre Hikayenin (Kıbrıs Türk Varyantı) Yapı Bakımından İncelenmesi

Original Article Turkish Studies International Periodical For the Languages, Literature and History of Turkish or Turkic, Volume *, Issue bahar 4/3, 2009, Pages 976-990

Abstract

various oral narratives that are collected from the Turkish Cypriot people. “Tahir ile Zühre” is one of those folk stories. In this article, first of all, we tried to define the fundamentals of the “folk stories”. After that, we tried to interpret the episode structure of “Tahir ile Zühre (Cyprus Turkish Variant)”. Finally, we completed our study by interpreting the motif examination of “Tahir ile Zühre”.


Özet

Kıbrıs Türk halkı arasından derlenmis çesitli sözlü anlatmalar içerisinde halk hikâyeleri önemli bir yer tutmaktadır. Bu halk hikâyelerinden bir tanesi de Tahir ile Zühre hikâyesidir. Biz çalısmamıza, ilk olarak halk hikâyesinin belli baslı tanımlarına yer vermeye çalıstık. Daha sonra da Tahir ile Zühre hikâyesinin Kıbrıs Türk varyantının epizot yapısını değerlendirmeye çalıstık. En son olarak da bu hikâyedeki motifleri değerlendirerek çalısmamızı tamamladık.

Kıbrıs Türk Halk Bilimi Çalışmalarının Değerlendirilmesi

Original Article International Periodical For the Languages, Literature and History of Turkish or Turkic, Volume -, Issue Bahar 4/3, 2009, Pages 2205-2237

Abstract

The history of folkore study in Turkish Republic of Northern Cyprus goes back to 1950s. Naturally, there are some studies that existed before this time. We will investigate and evaluate some of the folkore studies (books and articles) that were published in Cyprus and Turkey. We have also attemted to evaluate some B.Sc. projects, M.sc and ph.D thesis from Turkish universities. In addition, we have evaluated the activities of certain societies and foundations in Cyprus. Reference is made to publications of these societies and foundations.


Özet

Kuzey Kıbrıs Türk Cumhuriyeti’ndeki halk bilimi çalışmalarının tarihçesine baktığımız zaman 1950’li yıllardan sonraki tarihlerde halk bilimi çalışmalarının yoğunlaştığını görmekteyiz. Tabii ki bundan önceki tarihlerde de halk bilimiyle alakalı çalışmaların bulunduğunu görmekteyiz. Ancak bu çalışmaların sayısı çok fazla değildir. Bizim burada üzerinde duracağımız çalışmalar Kıbrıs’ta ve Türkiye’de, Kıbrıs Türk halk bilimiyle ilgili yayınlanmış kitap, makale ve bildiri çalışmalarıdır. Yayınlanmış çalışmalar yanında Türkiye üniversitelerinde hazırlanmış, ancak yayınlanmamış tezler de burada değerlendirilecektir. Bu tezler ağırlıklı olarak Kıbrıs’ın genel ve yerel ağızlarını değerlendiren çalışmalardır. Ancak bu tezler arasında Kıbrıs folkloruyla (genel-yerel) ilgili çalışmalar da bulunmaktadır. Bu ferdî çalışmaların ve yayınların yanında, Kıbrıs Türk halk bilimine katkıda bulunan kurum ve kuruluşlar da bulunmaktadır. Halk bilimi alanındaki ferdî çalışmaları değerlendirmemizin ardından söz konusu kurum ve kuruluşlardan ve yayınlarından bahsedilecektir.

Kıbrıs Türk Halk Masalları Üzerine Yapılan Çalışmaların İncelenmesi

Original Article Milli Folklor/Geleneksel Yayıncılık, Volume *, Issue 97, 2013, Pages 231-243

Abstract

-


Özet

Biz Kıbrıs’ta ve Türkiye’de doğrudan masalları ele alan veya dolaylı olarak masal ile ilgili hazırlanmış olan kitap, makale, bildiri ve tezleri değerlendirmeye çalışacağız. Bunu yaparken ilk olarak çalışmayı kısaca tanıtacağız. Bununla birlikte çalışmada kullanılan yöntemlerin bilimsel olup olmadığına bakarak; bunların Kıbrıs Türk masal çalışmalarına olan katkısını değerlendirmeye gayret göstereceğiz.

KKTC İlköğretim Kitaplarında Halk Edebiyatı Metinleri ile Halk Bilgisi Ürünlerinin Kullanımı Üzerine Bir İnceleme (A Research on the Use of Texts of Folk Literature and Products of Folklore in the Primary Education Books of TRNC)

Original Article International Journal of Languages’ Education and Teaching , Volume yok, Issue Özel sayı, 2015, Pages 347-365

Abstract

The more efficient use of texts of folk literature and products of folklore is extremely important in making contribution to the humorous and moral development of children, and to their social, musical, intellectual, physical and linguistic (reading comprehension, listening, writing, speaking) development. While these products are contributing to the child's education in various aspects, at the same time they provide a variety of desired behavior and provide education and transmission of culture. On the one hand while this education and transmission of culture ensures the survival of many elements, which are in danger of being lost in culture, on the other hand ensures the transmission of the culture to future generations. In our study, in total; we tried to examine 7 books from the first grade of primary school, 5 books from the second grade of primary school, 5 books from the third grade of primary school, 4 books from the fourth grade of primary school, 4 books from the fifth grade of primary school and two books from the music education book primary school (all 27 books). We have seen that in TRNC, the books used in the primary stage contain inadequacies and shortcomings in terms of folk literature and folklore.


Özet

Çocukların mizahi, ahlaki gelişimi ile sosyal, müzikal, zihinsel, bedensel ve dilsel (okuma, anlama, dinleme, yazma, konuşma) gelişimine katkı sağlamada halk edebiyatı metinlerinin ve halk bilgisi ürünlerinin daha etkin kullanımı son derece önemlidir. Örneğin; bir masal veya tekerleme metni çocuğun okuma, anlama gibi dilsel eğitiminde, sosyal-ahlaki gelişiminde, bilmeceler zihinsel, fıkralar mizahi, türküler ve ninniler sosyal-müzikal gelişiminde etkili olurken halk bilgisi ürünlerinden çocuk oyunları çocuğun sosyal, bedensel, zihinsel ve müzikal gelişiminde, halk dansları bedensel ve müzikal gelişiminde, halk sanatları el becerilerinin gelişiminde, gölge oyunları dinleme, anlama ve izleme yeteneklerinin gelişiminde etkili olmaktadırlar. Tabii bu ürünler çocuğun eğitimine çeşitli yönleriyle katkıda bulunurken aynı anda çeşitli istendik davranışlar da kazandırmakta ve kültür öğretimi ile aktarımını da sağlamaktadır. Bu kültür öğretimi ve aktarımı kültürde kaybolma tehlikesi altında olan birçok unsurun yaşamasını sağlarken bir yandan da kültürün gelecek nesillere aktarılmasını sağlamaktadır. Çalışmamızda toplamda; ilkokul birinci sınıflardan 7, ilkokul ikinci sınıflardan 5, ilkokul üçüncü sınıflardan 5, ilkokul dördüncü sınıflardan 4, ilkokul beşinci sınıflardan 4 kitabı ve iki de ilköğretim müzik eğitimi kitabını (tümü 27 kitap) incelemeye ve bu kitaplarda yer alan halk edebiyatı, halk bilgisi ve kültürel değerlerin tespitini yapmaya çalıştık. Daha sonra da kitaplarda eksik ve yetersiz bulduğumuz yönleri değerlendirerek öneri ve tekliflerde bulunmaya çalıştık.

In Terms of Principles of Children’s Literature, the Novel Entitled “Children of the Green Island”

Original Article The Social Sciences, Volume 11, Issue 8, 2016, Pages 1524.1530

Abstract

Children have spiritual-physical needs at every period. The aforementioned needs are provided by families, teachers, books. Children need literary works to learn life. Children’s literature works, contribute to the children’s world of sentiment and emotion. The works (books) which children shall read will differ at every developmental period because of this while preparing a text for them, a set of specialities, just like perception level, field of interest, spiritual world of the target audience must be considered. Havva Tekin has done an important contribution to the Cyprus Turkish children’s literature with her novel named “The children of Green Island”. The author tells the realities lived through 1974-1975 from the point of two children in the novel which was written by taking basic principles of children’s literature into consideration. A child will find indications from his/her own life in this documentarily novel that will cause him/her to read it with interest.


Özet

yok

Social Acceptance of Students with Special Needs from Peer Viewpoint

Original Article Eurasia Journal of Mathematics, Science and Technology Education, Volume 13, Issue 11, 2017, Pages 7287-7294

Abstract

Individuals with special needs have such rights as benefiting from health services and obtaining an education which is consistent with their abilities. As long as they can use these rights effectively like other individuals do, they are satisfied, active and productive in their social lives. Individuals with special needs who were ignored and neglected for centuries became socially accepted after social values began to change in a positive direction. This positive change was mostly felt in the field of education. The purpose of this study is to display the social acceptance level of students with special needs by normal peers in inclusive classes in TRNC (Turkish Republic of Northern Cyprus). According to the findings, female participant students show more positive social acceptance towards inclusive students compared to male students, and it was found out that social acceptance level does not show any difference based on age of the participants.


Özet

-

Analysis of children’s interest in books and their reading levels depending on the education status of family

Original Article Quality & Quantity, Volume 52, Issue 1, 2018, Pages 235-245

Abstract

The reading rate is an important indicator of the development level of a country.The fundamental condition of being a developed country is having a sufficiently educatedworkforce, which, in turn, is directly related to reading abilities and habits. In modernsociety, which has been termed the ‘‘information age’’, the fastest way to acquireknowledge is through reading. Reading habits are initially formed within the family.Subsequently, the desired reading objectives can be achieved through the positive con-tribution of the school and the child’s environment. A child with developed reading skillswill have the targeted accumulation of knowledge and will be suitably positioned to attainsuccess in their future education and professional lives. The ability to reach this objectiveeasily is directly related to the guidance and encouragement of families in this regard. Theresults of this study indicate that there is a strong correlation between the levels of edu-cation of parents in the Turkish Republic of Northern Cyprus and the reading habits thatare given to children. For example, the results revealed that the children of 27 families withuniversity and higher education levels read a total of 115 books, which is an average of4.25 books per child on a monthly basis, whereas this figure was found to be 42 books, oran average of 1.82 in the 23 families with an education at high school level or below. Thegeneral purpose of the study is to determine the relationship between the reading habits ofchildren and the education levels of their parents as well as the level of awareness offamilies in this respect. This is a qualitative study. The aim is to obtain in-depth anddetailed data. The research is based on a case study, which is a qualitative research model.The examined case is that of North Cyprus.


Özet

-

Perception and Attitudes of Local People on Sustainable Cultural Tourism on the Islands: The Case of Nicosia

Original Article Sustainability, Volume -, Issue 10, 2018, Pages 1892

Abstract

Today, for the sake of gaining tourism revenues, culture, nature and historical valuesare being ignored especially in island countries. As a result, tourism activities in the countrydecelerate and even vanish in time. According to the current tourism understanding, touristsare curious about the historical and cultural structure, which reflects the spirit of the region, and plantheir travels accordingly. In this sense, it is essential that sustainable cultural tourism policies aredetermined by people-government-civil society cooperatively. One of the first steps of this action isto determine the opinions and attitudes of local people on sustainable cultural tourism. In this paper,Nicosia, the capital city of Cyprus, was chosen as the research area and a survey was conductedwith 100 people living in this area in order to measure their perception and attitudes on sustainablecultural tourism and preservation of cultural heritage. SPSS 24.0 statistical package program wasused in analyzing the obtained data. Frequency, percentage and chi-square calculations were made.Based on the results of the study, it can be claimed that an environment should be created wherepeople of Nicosia would participate in tourism activities and some plans should be made to realizesuch an environment.


Özet

-

BERATLI Nazım, Kıbrıslı Türkler’in Kökenleri ve Kıbrıs’ta Bektaşilik

Review Milli Folklor Dergisi, Volume ..., Issue 112, 2016, Pages 168-171

Abstract

...


Özet

...

Currrent Teaching

  • 2019 Academic Year

    THEATER AND DRAMA APPLICATIONS

    Tiyatro/Yaratıcı drama çalışmalarından Türkçe öğretiminde faydalanabilmek, drama ve tiyatronun çocuk gelişimine katkılarını bilmek

  • 2019 Academic Year

    HISTORY OF TURKISH LITERATURE

  • 2019 YAZ

    HISTORY OF TURKISH LITERATURE

    Türk edebiyatının dönemlerini öğretmek, İslamiyet öncesi ve sonrası Türk edebiyatının özelliklerini öğretmek

  • 2019 YAZ

    HISTORY OF TURKISH LITERATURE

  • 2019 YAZ

    TURKISH FOLK LITERATURE I

    1.Halk edebiyatı tür ve şekillerini öğrenmek, 2. Halk edebiyatının özelliklerini öğrenmek, 3. Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavrayabilmek

Teaching History

  • 2014 BAHAR

    -

  • 2014 YAZ

    -

  • 2014 BAHAR

  • 2014 BAHAR

  • 2015 GÜZ

    COMPREHENSION TECHNIQUES II: LISTENING EDUCATION

    ...

  • 2018 GÜZ

    METHODOLOGY OF EXPRESSION

    Anlatım tekniklerinin uygulanması

  • 2018 Academic Year

    ORAL EXPRESSION

  • 2018 GÜZ

    ORAL EXPRESSION

  • 2016 GÜZ

    ANONYMOUS FOLK LITERATURE

    1- Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2017 GÜZ

    RESEARCH METHODS

    Tez ve makale yazımı için ön hazırlık, çalışma ve araştırma yapabilmek. Tez ve makale yazabilmek için yeterli bilgiye sahip olmak.

  • 2016 GÜZ

    ATATÜRK İLKELERİ VE İNKİLAP TARİHİ

  • 2018 BAHAR

    CHILD LITERATURE

    Bu derste çocuk edebiyatı ile ilgili kaynakların taranması ve tanıtımı; sınıf öğretmeni adaylarının çocukların seviyelerine uygun edebi ürünlerin seçimi ve değerlendirmesini yapabilmeleri; çocuk edebiyatına ilişkin örneklerin incelenmesi; folklor, masal, mit ve efsane, hikaye, şiir, biyografi gibi edebi türlerin çocukların gelişimlerine olan katkılarının incelenmesi ile ilgili becerileri kazanmaları hedeflenmektedir.

  • 2019 BAHAR

    CHILD LITERATURE

    Birer eğitimci olarak yukarıda belirtilen amaçlar doğrultusunda hayal güçleri gelişmiş farklı açılardan düşünen öğrenciler yetiştirmelerine yardımcı olmak.

  • 2019 BAHAR

    CHILD LITERATURE

    Bu derste çocuk edebiyatı ile ilgili kaynakların taranması ve tanıtımı; sınıf öğretmeni adaylarının çocukların seviyelerine uygun edebi ürünlerin seçimi ve değerlendirmesini yapabilmeleri; çocuk edebiyatına ilişkin örneklerin incelenmesi; folklor, masal, mit ve efsane, hikaye, şiir, biyografi gibi edebi türlerin çocukların gelişimlerine olan katkılarının incelenmesi ile ilgili becerileri kazanmaları hedeflenmektedir.

  • 2017 BAHAR

    LANGUAGE AND CULTURE

  • 2018 BAHAR

    LANGUAGE AND CULTURE

  • 2014 BAHAR

    WORLD MYTHOLOGY

  • 2015 BAHAR

    WORLD MYTHOLOGY

  • 2019 GÜZ

    LITERARY KNOWLEDGE AND THEORIES I

  • 2019 GÜZ

    LITERARYKNOWLEDGES 1

    Tür edebiyatındaki nesir ve nazım bilgileri hakkında malumat edinmek ve metinler üzerinde tespitleri anlamak.

  • 2014 BAHAR

    KNOWLEDGE OF LİTERATURE

    EDEBİ BİLGİ SAHİBİ OLMA

  • 2015 GÜZ

    LITERARYTHEORY

  • 2014 BAHAR

    LITERARYKNOWLEDGESII

    -

  • 2016 GÜZ

    FOREIGN LANGUAGE

  • 2014 BAHAR

    FOREIGN LANGUAGE I

  • 2015 BAHAR

    FOREIGN LANGUAGE I

  • 2015 GÜZ

    FOREIGN LANGUAGE I

  • 2016 GÜZ

    FOREIGN LANGUAGE I

  • 2014 BAHAR

    FOREIGN LANGUAGE II

  • 2015 BAHAR

    FOREIGN LANGUAGE II

  • 2015 GÜZ

    FOREIGN LANGUAGE II

  • 2018 GÜZ

    PRACTICAL CYPRUS FOLK LITERATURE

    yok

  • 2014 BAHAR

    CYPRUS TURKIS HFOLKLORE

    yok

  • 2018 BAHAR

    CULTURAL HERITAGE

    ...

  • 2019 BAHAR

    CULTURAL HERITAGE

    ...

  • 2016 BAHAR

    THEORETICAL EXAMINATION OF THE TALES

    Bu dersin amacı masalın tür özelliklerini kavratmak ve bu tür üzerinde araştırma yapabilme yeteneği geliştirmek ve masal incelemesi yapmaktır.

  • 2017 BAHAR

    GRADUATION WORK/THESIS

    araştırma yöntemlerini öğrenme

  • 2018 BAHAR

    GRADUATION WORK/THESIS

    araştırma yöntemlerini öğrenme

  • 2018 BAHAR

    SEMINAR

    bilimsel çalışma ve yazımı öğretmek

  • 2016 BAHAR

    Our Intangible Cultural Heritage

    1) Araştırma odağını güçlendirmek; 2) Araştırma sorusunu keskinleştirmek ve arıtmak; 3) Çeşitli teorik ve metodolojik yaklaşımları ve araştırma etiğini belirgin hale getirmek; 4) Arşiv ve kütüphane araştırmasıyla ilgili pratik beceriler geliştirmek; 5) Bilimsel inceleme ve sunum becerilerinin düzenini geliştirmektir.

  • 2016 GÜZ

    ORAL COMMUNICATION I

    Sözlü anlatım dersinin amacı öğrencilere doğru ve etkili konuşma beceri ve alışkanlığını kazandırmak, Türkçeyi güzel kullanmanın önemini kavratmaktır.

  • 2019 GÜZ

    ORAL COMMUNICATION I

    Sözlü anlatım dersinin amacı öğrencilere doğru ve etkili konuşma beceri ve alışkanlığını kazandırmak, Türkçeyi güzel kullanmanın önemini kavratmaktır.

  • 2016 BAHAR

    ORAL COMMUNICATION II

    • Bu derste Konferans, Söylev(Nutuk/Hitabet), Panel, Forum, Sempozyum, Münazara, Açık Oturum vb. türlerin uygulamalı olarak öğretmek • Konuşmada kullanılabilecek anlatım biçimleri nin anlatmak • Değişik konularda hazırlıklı konuşma yapmak, • Konuşmalardaki dil ve anlatım yanlışlarını düzeltmek, • Uygulamalı diksiyon çalışmaları yapmak.

  • 2016 BAHAR

    PRACTICAL ORAL LITERATURE

    1- Sözlü edebiyatı tür ve şekillerini öğrenmek. 2- Sözlü edebiyatının özelliklerini öğrenmek. 3- Sözlü edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2019 GÜZ

    THEATER AND DRAMA APPLICATIONS

    Tiyatro/Yaratıcı drama çalışmalarından Türkçe öğretiminde faydalanabilmek, drama ve tiyatronun çocuk gelişimine katkılarını bilmek

  • 2019 GÜZ

    THEATRE AND DRAMA APPLICATIONS

    ...

  • 2014 BAHAR

    TURKISH LANGUAGE

  • 2015 BAHAR

    TURKISH LANGUAGE

  • 2015 GÜZ

    TURKISH LANGUAGE

  • 2015 BAHAR

    TURKISH LANGUAGE II

  • 2015 GÜZ

    TURKISH LANGUAGE II

  • 2015 BAHAR

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 BAHAR

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2017 BAHAR

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 GÜZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2017 GÜZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 YAZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2017 YAZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2014 BAHAR

    TURKISH FOR FOREIGNER ST.

  • 2015 BAHAR

    TURKISH FOR FOREIGNER ST.

  • 2016 GÜZ

    TURKISH FOR FOREIGNER ST.

  • 2013 AKADEMİK YILI

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2015 AKADEMİK YILI

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2016 AKADEMİK YILI

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2017 AKADEMİK YILI

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2018 AKADEMİK YILI

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2016 GÜZ

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2015 GÜZ

    TÜRK DİLİ

  • 2019 GÜZ

    HISTORY OF TURKISH LITERATURE

    Türk edebiyatının dönemlerini öğretmek, İslamiyet öncesi ve sonrası Türk edebiyatının özelliklerini öğretmek

  • 2018 GÜZ

    HISTORY OF TURKISH LITERATURE

  • 2019 GÜZ

    HISTORY OF TURKISH LITERATURE

  • 2018 YAZ

    HISTORY OF TURKISH LITERATURE

  • 2016 GÜZ

    TURKISH FOLKLORE

    Halk bilgisi kurallarını ve kuramlarını bilmek, Türk kültürünü anlayabilmek, folklorun tanımını ve kapsamını bilmek,

  • 2016 GÜZ

    TURKISH FOLKLORE

    Halk bilgisi kurallarını ve kuramlarını bilmek, Türk kültürünü anlayabilmek, folklorun tanımını ve kapsamını bilmek,

  • 2015 GÜZ

    TURKISH FOLK LITERATURE 1

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2016 GÜZ

    TURKISH FOLK LITERATURE 1

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2017 GÜZ

    TURKISH FOLK LITERATURE 1

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2018 GÜZ

    TURKISH FOLK LITERATURE 1

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2019 GÜZ

    TURKISH FOLK LITERATURE 1

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2015 GÜZ

    -

    - Halk edebiyatı tür ve şekillerini öğrenmek. 2- Halk edebiyatının özelliklerini öğrenmek. 3- Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavramak.

  • 2014 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2015 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halk edebiyatı tür ve şekillerini öğrenmek. 2. Halk edebiyatı tür ve şekillerini tahlil ve inceleme yapmayı öğrenmek. 3. Âşık edebiyatı tür ve şekillerini öğrenmek. 4. Anonim halk şiiri tür ve şekillerini öğrenmek.

  • 2015 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2016 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2017 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2018 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2019 BAHAR

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2015 YAZ

    TURKISH FOLK LITERATURE 2

    1. Halkedebiyatıtürveşekilleriniöğrenmek. 2. Halkedebiyatıtürveşekillerinitahlilveincelemeyapmayıöğrenmek. 3. Âşıkedebiyatıtürveşekilleriniöğrenmek. 4. Anonimhalkşiiritürveşekilleriniöğrenmek.

  • 2015 GÜZ

    TURKISH FOLK LITERATURE I

    1.Halk edebiyatı tür ve şekillerini öğrenmek, 2. Halk edebiyatının özelliklerini öğrenmek, 3. Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavrayabilmek

  • 2017 GÜZ

    TURKISH FOLK LITERATURE I

    1.Halk edebiyatı tür ve şekillerini öğrenmek, 2. Halk edebiyatının özelliklerini öğrenmek, 3. Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavrayabilmek

  • 2018 GÜZ

    TURKISH FOLK LITERATURE I

    1.Halk edebiyatı tür ve şekillerini öğrenmek, 2. Halk edebiyatının özelliklerini öğrenmek, 3. Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavrayabilmek

  • 2019 GÜZ

    TURKISH FOLK LITERATURE I

    1.Halk edebiyatı tür ve şekillerini öğrenmek, 2. Halk edebiyatının özelliklerini öğrenmek, 3. Halk edebiyatının Türk edebiyatı içerisindeki yeri ve önemini kavrayabilmek

  • 2014 BAHAR

    TURKISH FOLK LITERATURE II

    ...

  • 2015 BAHAR

    TURKISH FOLK LITERATURE II

    ...

  • 2017 BAHAR

    TURKISH FOLK LITERATURE II

    ...

  • 2018 BAHAR

    TURKISH FOLK LITERATURE II

    ...

  • 2019 BAHAR

    TURKISH FOLK LITERATURE II

    ...

  • 2016 GÜZ

    HISTORY OF TURKISH CULTURE

    1. Kültürün tanımını bilmek, 2. Kültürün özelliklerini bilmek, 3. Türk kültür tarihini bilmek, 4. Türk kültür tarihini değerlendirip yorumlayabilmek. 5. Somüt Olmayan Kültürel Miras (SOKÜM) Sözleşmesinin içeriği ve önemini bilmek.

  • 2018 YAZ

    TURKISH TEXTBOOK REVIEW

    ...

  • 2014 BAHAR

    TURKISH I

  • 2015 BAHAR

    TURKISH I

  • 2015 GÜZ

    TURKISH I

  • 2016 GÜZ

    TURKISH I

  • 2017 GÜZ

    TURKISH COMPOSITION 1

    Düzgün, kurallı bir Türkçe ile yazılı anlatım yapabilmek

  • 2016 BAHAR

    TURKISH COMPOSITION 2

    • Yazı dilindeki imla ve noktalama kurallarını uygulayabilmek • Türkçeyi yazılı-sözlü etkili ve güzel olarak kullanabilmek • Dilekçe, tutanak, rapor gibi yazışmaları eksiksiz yapabilmek • Sözlü (konferans, açık oturum, panel, sempozyum…) ve yazılı (makale, deneme, fıkra, sohbet, biyografi…) türleri tanıyabilmek ve uygulayabilmek. • Kurallara uygun iyi kompozisyon yazabilmek.

  • 2017 BAHAR

    TURKISH COMPOSITION 2

    • Yazı dilindeki imla ve noktalama kurallarını uygulayabilmek • Türkçeyi yazılı-sözlü etkili ve güzel olarak kullanabilmek • Dilekçe, tutanak, rapor gibi yazışmaları eksiksiz yapabilmek • Sözlü (konferans, açık oturum, panel, sempozyum…) ve yazılı (makale, deneme, fıkra, sohbet, biyografi…) türleri tanıyabilmek ve uygulayabilmek. • Kurallara uygun iyi kompozisyon yazabilmek.

  • 2015 GÜZ

    TURKISHFOLKLITERATUREIII

  • 2014 BAHAR

    HISTORYOFTURKISHCULTURE

    Türk kültür tarihinin dönemlerini öğrenmek, kültürün tanımını yapabilmek, Türk kültürüne ait bilgileri öğrenmek

  • 2015 BAHAR

    HISTORYOFTURKISHCULTURE

    Türk kültür tarihinin dönemlerini öğrenmek, kültürün tanımını yapabilmek, Türk kültürüne ait bilgileri öğrenmek

  • 2016 GÜZ

    TURKISH FOR FOREIGNERS

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENTS

    .

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENTS

    .

  • 2016 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENTS

    .

  • 2016 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2016 GÜZ

    TURKISH FOR FOREIGN STUDENTS

    .

  • 2016 BAHAR

    Turkish for International Students

    Türkçe dil becerilerini öğretmek

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2016 GÜZ

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2016 GÜZ

    TURKISH FOR FOERIGNERS

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENT

    .

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENT

    .

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENT

    .

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2014 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 BAHAR

    TURKISH FOR FOREIGN STUDENTS

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2015 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2016 GÜZ

    TURKISH FOR FOREIGN STUDENTS

  • 2016 GÜZ

    TURKISH FOR FOREIGNER

  • 2014 BAHAR

    TURKISH FOR FOREIGNERS

  • 2015 BAHAR

    TURKISH FOR FOREIGNERS

  • 2015 GÜZ

    TURKISH FOR FOREIGNERS

  • 2016 GÜZ

    TURKISH FOR FOREIGNERS

  • 2016 YAZ

    TURKISH FOR FOREIGNERS

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 GÜZ

    TURKISH FOR INTERNATIONAL STUDENT

  • 2016 GÜZ

    TURKISH FOR INTERNATIONAL STUDENTS

  • 2017 BAHAR

    TURKISH FOR INTERNATIONALS STUDENTS

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 GÜZ

    TURKISH FOR INTERNATIONALS STUDENTS

  • 2017 GÜZ

    TURKISH FOR INTERNATIONALS STUDENTS

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 BAHAR

    TURLKISH FOR FOREIGNERS

    Türkçe becerileri geliştirmek

  • 2017 BAHAR

    TURKISH LANGUAGE FOR FOR INTERNATIONAL STUDENTS 2

  • 2017 GÜZ

    TURKISH LANGUAGE FOR FOR INTERNATIONAL STUDENTS 2

  • 2017 GÜZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS 3

    Türkçe okuma, anlama, konuşma, dinleme becerilerini geliştirmek, Konuşma ve yazıda ilerlemek, Okuma anlamayı daha etkili hale getirmek.

  • 2018 GÜZ

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS 3

    Türkçe okuma, anlama, konuşma, dinleme becerilerini geliştirmek, Konuşma ve yazıda ilerlemek, Okuma anlamayı daha etkili hale getirmek.

  • 2016 BAHAR

    TURKISH LANGUAGE FOR FOR INTERNATIONAL STUDENTS 4

    Türkçe dil becerilerini öğretmek

  • 2017 BAHAR

    TURKISH LANGUAGE FOR INTERNATIONAL STUDENTS I

    Okuma, yazma, konuşma vb. Türkçe dil becerilerini geliştirebilmek.

  • 2016 GÜZ

    TURKISH FOR INTERNATIONAL STUDENTS I

  • 2015 BAHAR

    TEACHING TURKISH TO FOREIGNERS

    Belirlenen kavramları açıklamak, Seçilen becerileri geliştirmek, Seçilen konuları derinlemesine incelemek, Yeniliği teşvik etmek, Eleştirel düşünceyi geliştirmek

  • 2016 BAHAR

    TEACHING TURKISH TO FOREIGNERS

    Belirlenen kavramları açıklamak, Seçilen becerileri geliştirmek, Seçilen konuları derinlemesine incelemek, Yeniliği teşvik etmek, Eleştirel düşünceyi geliştirmek

  • 2018 BAHAR

    TEACHING TURKISH TO FOREIGNERS

    Belirlenen kavramları açıklamak, Seçilen becerileri geliştirmek, Seçilen konuları derinlemesine incelemek, Yeniliği teşvik etmek, Eleştirel düşünceyi geliştirmek

  • 2019 BAHAR

    TEACHING TURKISH TO FOREIGNERS

  • 2019 BAHAR

    TEACHING TURKISH TO FOREIGNERS

    Belirlenen kavramları açıklamak, Seçilen becerileri geliştirmek, Seçilen konuları derinlemesine incelemek, Yeniliği teşvik etmek, Eleştirel düşünceyi geliştirmek

  • 2016 BAHAR

    FOLK CULTURE IN MODERN TURKISH LITERATURE

    • Yeni edebiyatta kullanılan kültürel değerleri öğretmek, • Yeni edebiyatta kullanılan halk edebiyatı tür ve şekillerini öğretmek , • Öğrencinin modern edebiyat metni içinde yer alan halk kültürü ve edebiyatı unsurlarını tespit edebilmesini sağlamak, • Yeni edebiyat ve kültürel öğelerin ilişkisini bilmek, anlamak ve çözünleyebilmek.

At My Office

Fen ve Edebiyat Fakültesi, Ofis no: 5-D-110